Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00080.69
Common NameAMTR_s00080p00153120, LOC18433122
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 195aa    MW: 21270 Da    PI: 6.7538
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00080.69genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70 
                                              +CaaCk+lrr+Ca+ C+lapyfp +qp kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+r
                                              7********************************************************************* PP

                                   DUF260  71 dPvyGavgvilklqqqleqlkaelallkee 100
                                              dPvyG++g i++lq+q+++l+++la+++++
  evm_27.model.AmTr_v1.0_scaffold00080.69 106 DPVYGSAGAIFQLQKQVSELQTQLATAQAQ 135
                                              **************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.67135136IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-4236133IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006843281.11e-143PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR04e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW1PBG51e-143W1PBG5_AMBTC; Uncharacterized protein
STRINGGLYMA13G40370.23e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-64LOB domain-containing protein 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089